PDB entry 5ums

View 5ums on RCSB PDB site
Description: Crystal structure of middle double PH domain of human FACT complex subunit SSRP1
Class: transcription
Keywords: Histone chaperone; Double PH domain; FACT; Transcription, TRANSCRIPTION
Deposited on 2017-01-29, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FACT complex subunit SSRP1
    Species: Homo sapiens [TaxId:9606]
    Gene: SSRP1, FACT80
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5umsA (A:)
    gvdpveafaqnvlskadviqatgdaicifrelqcltprgrydiriyptflhlhgktfdyk
    ipyttvlrlfllphkdqrqmffvisldppikqgqtryhflillfskdedisltlnmneee
    vekrfegrltknmsgslyemvsrvmkalvnrkitvpgnfqghsgaqcitcsykassglly
    plergfiyvhkppvhirfdeisfvnfargttttrsfdfeietkqgtqytfssiereeygk
    lfdfvnakklniknrglkegmnps
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umsA (A:)
    qatgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrq
    mffvisldppikqgqtryhflillfskdedisltlnmneeevekrfegrltknmsgslye
    mvsrvmkalvnrkitvpgnfqghsgaqcitcsykassgllyplergfiyvhkppvhirfd
    eisfvnfargttttrsfdfeietkqgtqytfssiereeygklfdfvnakklniknrgl