PDB entry 5ulv

View 5ulv on RCSB PDB site
Description: Malate dehydrogenase from Methylobacterium extorquens
Class: oxidoreductase
Keywords: malate, dehydrogenase, NAD, OXIDOREDUCTASE
Deposited on 2017-01-25, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Gene: MDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ulva1, d5ulva2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ulvA (A:)
    marskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdaky
    sgasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicit
    npldamvwalqkfsglptnkvvgmagvldsarfrhflaeefgvsvedvtafvlgghgddm
    vpltrystvagvpltdlvklgwttqekldamvertrkgggeivnllktgsafyapaasai
    amaesylrdkkrvlpcaayldgqygidglyvgvpvvigengvervlevtfnddekamfek
    svnsvkglieacksvndkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ulvA (A:)
    arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys
    gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn
    pldamvwalqkfsglptnkvvgmagvldsarfrhflaeefgvsvedvtafvlgghgddmv
    pltrystvagvpltdlvklgwttqekldamvertrkgggeivnllktgsafyapaasaia
    maesylrdkkrvlpcaayldgqygidglyvgvpvvigengvervlevtfnddekamfeks
    vnsvkglieacksvndkl