PDB entry 5ujt

View 5ujt on RCSB PDB site
Description: Crystal structure of human HLA-DQ8 in complex with insulin mimotope binding in register 3
Class: immune system
Keywords: insulin, type I diabetes, t cell, autoimmune disease, immune system
Deposited on 2017-01-18, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y7C3 (Start-184)
      • conflict (75)
    Domains in SCOPe 2.07: d5ujta1, d5ujta2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ujtb1, d5ujtb2
  • Chain 'C':
    Compound: insulin mimotope
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UJT (Start-15)
  • Chain 'D':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y7C3
      • conflict (75)
    Domains in SCOPe 2.07: d5ujtd1, d5ujtd2
  • Chain 'E':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ujte1, d5ujte2
  • Chain 'F':
    Compound: insulin mimotope
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UJT
  • Chain 'G':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y7C3 (0-End)
      • conflict (75)
    Domains in SCOPe 2.07: d5ujtg1, d5ujtg2
  • Chain 'H':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ujth1, d5ujth2
  • Chain 'I':
    Compound: insulin mimotope
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UJT
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ujtA (A:)
    gedivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdp
    qfaltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppv
    vnitwlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllk
    hwepe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ujtA (A:)
    divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
    altniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllkhw
    epe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ujtB (B:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvtdf
    ypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqn
    piivewraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ujtB (B:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispstealnhhnllvcsvtdfy
    paqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnp
    iivewraq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ujtD (D:)
    gedivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdp
    qfaltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppv
    vnitwlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllk
    hwepe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ujtD (D:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllkh
    w
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ujtE (E:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvtdf
    ypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqn
    piivewraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ujtE (E:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvtdf
    ypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqn
    piivewra
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ujtG (G:)
    gedivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdp
    qfaltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppv
    vnitwlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllk
    hwepe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ujtG (G:)
    gedivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdp
    qfaltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppv
    vnitwlsnghsvtegvsetsflsksdhsffkisyltflpsddeiydckvehwgldepllk
    hw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ujtH (H:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvtdf
    ypaqikvrwfrndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqn
    piivewraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ujtH (H:)
    spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
    sqkevlertraeldtvcrhnyqlelrttlqrrveptvtispnllvcsvtdfypaqikvrw
    frndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivewra
    

  • Chain 'I':
    No sequence available.