PDB entry 5uiz

View 5uiz on RCSB PDB site
Description: Structure of T.fusca AA10A
Class: lyase
Keywords: aa10a, polysaccharide monooxygenase, oxidoreductase, e7, lpmo, lyase
Deposited on 2017-01-16, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aa10a
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uiza_
  • Chain 'B':
    Compound: aa10a
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uizb_
  • Heterogens: CU, GOL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uizA (A:)
    mhrysrtgkhrwtvralavlftallgltqwtapasahgsvinpatrnygcwlrwghdhln
    pnmqyedpmcwqawqdnpnamwnwnglyrdwvggnhraalpdgqlcsgglteggryrsmd
    avgpwkttdvnntftihlydqashgadyflvyvtkqgfdpttqpltwdslelvhqtgsyp
    paqniqftvhapnrsgrhvvftiwkashmdqtyylcsdvnfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uizA (A:)
    hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
    raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
    gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
    sdvnfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uizB (B:)
    mhrysrtgkhrwtvralavlftallgltqwtapasahgsvinpatrnygcwlrwghdhln
    pnmqyedpmcwqawqdnpnamwnwnglyrdwvggnhraalpdgqlcsgglteggryrsmd
    avgpwkttdvnntftihlydqashgadyflvyvtkqgfdpttqpltwdslelvhqtgsyp
    paqniqftvhapnrsgrhvvftiwkashmdqtyylcsdvnfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uizB (B:)
    hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
    raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
    gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
    sdvnfv