PDB entry 5uii

View 5uii on RCSB PDB site
Description: structure of DHFR with bound buformin and NADP
Class: oxidoreductase
Keywords: DHFR, buformin, NADP, OXIDOREDUCTASE
Deposited on 2017-01-14, released 2018-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (1-158)
      • expression tag (0)
      • engineered mutation (151)
    Domains in SCOPe 2.08: d5uiia1, d5uiia2
  • Heterogens: NAP, CA, NA, BFR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5uiiA (A:)
gisliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsysfeilerrgggg

    Sequence, based on observed residues (ATOM records): (download) 
    >5uiiA (A:)
gisliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsysfeilerr