PDB entry 5uhx

View 5uhx on RCSB PDB site
Description: Structure of cellulase Cel5C_1
Class: hydrolase
Keywords: cellulase, rumen Bacteroidetes, AC2a Bacteroidetes, GH5, HYDROLASE
Deposited on 2017-01-12, released 2017-11-22
Made obsolete on 2019-06-26

The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbohydrate-active enzyme
    Species: uncultured organism [TaxId:155900]
    Gene: SARM_0026
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9NSK2 (0-317)
      • expression tag (318-322)
    Domains in SCOPe 2.06: d5uhxa1, d5uhxa2
  • Heterogens: EDO, 1PE, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5uhxA (A:)
    typegspvyhngklsvqgtqmvsecgkpvqlrgmsshglawfpkcyteasltalvkdwni
    difrlaiythewggyttnqwkskddynayidnmvdicaklgiyciidwhvlndgsgdpny
    tlddaipfwdymsakhkddkhvlyeicnepngfdvkwadvkeyaeavipvirkndpdkii
    icgtptwsqdvdlaaqdplsydnvmytlhfysgthtqylrdkaqvainkglalfvtefgt
    tqasgdggvyfdecntwmdwmdarkiswvnwsfadkpessaalkpgasnsgdwnmvsesg
    qyikrklsqpksyescgghhhhh