PDB entry 5uht

View 5uht on RCSB PDB site
Description: Structure of the Thermotoga maritima HK853-BeF3-RR468 complex at pH 5.0
Class: transferase/signaling protein
Keywords: Two component system HK853 RR468, TRANSFERASE-SIGNALING PROTEIN complex
Deposited on 2017-01-12, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor histidine kinase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uhta1, d5uhta2
  • Chain 'B':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uhtb_
  • Chain 'C':
    Compound: sensor histidine kinase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uhtc1, d5uhtc2
  • Chain 'D':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uhtd_
  • Heterogens: ADP, GOL, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uhtA (A:)
    mvenvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlke
    fleviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvn
    vlfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliive
    dngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgs
    rffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uhtA (A:)
    lkridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhle
    nllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpvea
    yidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliivedngigipdhakdr
    ifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsrffvwipkdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uhtB (B:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uhtB (B:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    n
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uhtC (C:)
    mvenvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlke
    fleviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvn
    vlfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliive
    dngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgs
    rffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uhtC (C:)
    lkridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhle
    nllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpvea
    yidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliivedngigipdhakdr
    ifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsrffvwipkdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uhtD (D:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uhtD (D:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    n