PDB entry 5ufq

View 5ufq on RCSB PDB site
Description: K-RasG12D(GNP)/R11.1.6 complex
Class: Hydrolase/DE NOVO PROTEIN
Keywords: Ras, GTPase, complex, inhibitor, Hydrolase-DE NOVO PROTEIN complex
Deposited on 2017-01-05, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-165)
      • engineered mutation (11)
    Domains in SCOPe 2.06: d5ufqa_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-165)
      • engineered mutation (11)
    Domains in SCOPe 2.06: d5ufqb_
  • Chain 'C':
    Compound: r11.1.6
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5UFQ (0-End)
    Domains in SCOPe 2.06: d5ufqc_
  • Chain 'D':
    Compound: r11.1.6
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5UFQ (0-60)
    Domains in SCOPe 2.06: d5ufqd_
  • Heterogens: GNP, MG, CL, CA, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ufqA (A:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ufqB (B:)
    mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ufqC (C:)
    atvkfthqgeekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqmlkk
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufqC (C:)
    atvkftgeekqvdiskikwvirwgqyiwfkydeggkgwgyvsekdapkellqmlkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ufqD (D:)
    atvkfthqgeekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqmlkk
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufqD (D:)
    atvkfteekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqmlkkr