PDB entry 5ufp

View 5ufp on RCSB PDB site
Description: Crystal structure of PT2399 bound to HIF2a-B*:ARNT-B* complex
Class: transcription
Keywords: HIF2 inhibitor HIF2 ligand PAS-B hypoxia inducible factor 2 EPAS1, TRANSCRIPTION
Deposited on 2017-01-05, released 2017-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial PAS domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPAS1, BHLHE73, HIF2A, MOP2, PASD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99814 (5-End)
      • engineered mutation (13)
    Domains in SCOPe 2.08: d5ufpa_
  • Chain 'B':
    Compound: Aryl hydrocarbon receptor nuclear translocator
    Species: Homo sapiens [TaxId:9606]
    Gene: ARNT, BHLHE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27540 (Start-116)
      • engineered mutation (11)
    Domains in SCOPe 2.08: d5ufpb_
  • Heterogens: 86D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ufpA (A:)
geflgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtksh
qnlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseie

    Sequence, based on observed residues (ATOM records): (download) 
    >5ufpA (A:)
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlse

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5ufpB (B:)
geflgnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrd
sfqqvvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

    Sequence, based on observed residues (ATOM records): (download) 
    >5ufpB (B:)
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns