PDB entry 5ufo

View 5ufo on RCSB PDB site
Description: Structure of RORgt bound to
Class: nuclear protein
Keywords: Nuclear Hormone Receptor, NUCLEAR PROTEIN
Deposited on 2017-01-05, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ufoa_
  • Heterogens: 87J

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ufoA (A:)
    ghhhhhhgenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyq
    rksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcray
    nadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinah
    rpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhl
    hpivvqaafpplykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufoA (A:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhl