PDB entry 5ueo

View 5ueo on RCSB PDB site
Description: brd4_bd2_a-1395017
Class: signaling protein/inhibitor
Keywords: SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2017-01-03, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (3-108)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5ueoa1, d5ueoa2
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (3-108)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5ueob1, d5ueob2
  • Heterogens: 87G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ueoA (A:)
    shmeqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ueoA (A:)
    hmeqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksklea
    reyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ueoB (B:)
    shmeqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm