PDB entry 5ue2

View 5ue2 on RCSB PDB site
Description: proMMP-7 with heparin octasaccharide bridging between domains
Class: hydrolase
Keywords: glycan complex with protein, enzyme complex with heparin oligosaccharide, zymogen, HYDROLASE
Deposited on 2016-12-29, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrilysin
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP7, MPSL1, PUMP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09237 (0-246)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d5ue2a1, d5ue2a2
  • Heterogens: CA, ZN, SGN, IDS

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ue2A (A:)
    pqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvie
    imqkprcgvpdvaeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkei
    plhfrkvvwgtadimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtd
    gsslginflyaathalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk
    rsnsrkk