PDB entry 5ue1

View 5ue1 on RCSB PDB site
Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase in complex with adenine from Vibrio fischeri ES114
Class: hydrolase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE, NUCLEAR PROTEIN, Hydrolase
Deposited on 2016-12-29, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: mtnN, VF_2128
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E2X3 (3-233)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5ue1a1, d5ue1a2
  • Chain 'B':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Vibrio fischeri (strain ATCC 700601 / ES114) [TaxId:312309]
    Gene: mtnN, VF_2128
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E2X3 (3-233)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d5ue1b1, d5ue1b2
  • Heterogens: 9DA, TRS, CA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ue1A (A:)
    snamkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaav
    gttlliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpa
    afiadeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeas
    aiaqtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ue1A (A:)
    namkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaavg
    ttlliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpaa
    fiadeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeasa
    iaqtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ue1B (B:)
    snamkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaav
    gttlliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpa
    afiadeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeas
    aiaqtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ue1B (B:)
    namkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaavg
    ttlliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpaa
    fiadeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeasa
    iaqtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk