PDB entry 5ucw

View 5ucw on RCSB PDB site
Description: Cytochrome P411 P-4 A82L A78V F263L amination catalyst
Class: oxidoreductase
Keywords: engineered, C-H functionalization, nitrene transfer, P411CHA, OXIDOREDUCTASE
Deposited on 2016-12-22, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADPH-cytochrome P450 reductase 102A1V3
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Q7T0
      • engineered mutation (82)
      • engineered mutation (87)
      • engineered mutation (142)
      • engineered mutation (175)
      • engineered mutation (184)
      • engineered mutation (226)
      • engineered mutation (236)
      • engineered mutation (252)
      • engineered mutation (263)
      • engineered mutation (268)
      • engineered mutation (290)
      • engineered mutation (328)
      • engineered mutation (353)
      • engineered mutation (366)
      • engineered mutation (400)
      • engineered mutation (438)
      • engineered mutation (442)
    Domains in SCOPe 2.07: d5ucwa_
  • Chain 'B':
    Compound: NADPH-cytochrome P450 reductase 102A1V3
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Q7T0
      • engineered mutation (82)
      • engineered mutation (87)
      • engineered mutation (142)
      • engineered mutation (175)
      • engineered mutation (184)
      • engineered mutation (236)
      • engineered mutation (252)
      • engineered mutation (263)
      • engineered mutation (268)
      • engineered mutation (290)
      • engineered mutation (328)
      • engineered mutation (353)
      • engineered mutation (366)
      • engineered mutation (400)
      • engineered mutation (438)
      • engineered mutation (442)
    Domains in SCOPe 2.07: d5ucwb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ucwA (A:)
    mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlik
    eacdesrfdknlsqalkfvrdflgdglatswtheknwkkahnillpsfsqqamkgyhamm
    vdiavqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvr
    aldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkargeqsddlltqmln
    gkdpetgeplddgniryqiitfllaghegtsgllsfalyflvknphvlqkvaeeaarvlv
    dpvpsykqvkqlkyvgmvlnealrlwptvpafslyakedtvlggeyplekgdevmvlipq
    lhrdktvwgddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlk
    hfdfedhtnyeldiketlslkpkgfvvkakskkiplggipspstlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucwA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdflgdglatswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvra
    ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkargeqsddlltqmlng
    kdpetgeplddgniryqiitfllaghegtsgllsfalyflvknphvlqkvaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptvpafslyakedtvlggeyplekgdevmvlipql
    hrdktvwgddveefrperfenaipqhafkpfgngqrasigqqfalheatlvlgmmlkhfd
    fedhtnyeldiketlslkpkgfvvkakskkipl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ucwB (B:)
    mtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlik
    eacdesrfdknlsqalkfvrdflgdglatswtheknwkkahnillpsfsqqamkgyhamm
    vdiavqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvr
    aldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkargeqsddlltqmln
    gkdpetgeplddgniryqiitfllaghegtsgllsfalyflvknphvlqkvaeeaarvlv
    dpvpsykqvkqlkyvgmvlnealrlwptvpafslyakedtvlggeyplekgdevmvlipq
    lhrdktvwgddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlk
    hfdfedhtnyeldiketlslkpkgfvvkakskkiplggipspstlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucwB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdflgdglatswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievsedmtrltldtiglcgfnyrfnsfyrdqphpfiismvra
    ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkaddlltqmlngkdpet
    geplddgniryqiitfllaghegtsgllsfalyflvknphvlqkvaeeaarvlvdpvpsy
    kqvkqlkyvgmvlnealrlwptvpafslyakedtvlggeyplekgdevmvlipqlhrdkt
    vwgddveefrperfenpsaipqhafkpfgngqrasigqqfalheatlvlgmmlkhfdfed
    htnyeldiketlslkpkgfvvkakskkiplggi