PDB entry 5ucc

View 5ucc on RCSB PDB site
Description: Crystal structure of the ENTH domain of ENT2 from Candida albicans
Class: lipid binding protein
Keywords: ENTH domain, predicted lipid binding protein, endocytosis, all alpha protein, structural genomics, center for structural genomics of infectious diseases, CSGID, NIAID, national institute of allergy and infectious diseases, LIPID BINDING PROTEIN
Deposited on 2016-12-22, released 2017-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potential epsin-like clathrin-binding protein
  Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
  Gene: ENT2, orf19.1444, CaO19.1444
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5AMD1
  Domains in SCOPe 2.08: d5ucca_
• Heterogens: CL, CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5uccA (A:)
  msklvrsiknvaggyssaqrvvrnatsndptgpttfdmeeissftyqsqtefmevmdmld
  rrlndkgknwrhvaksltvldylvrygsdkcvlwakdnlyiiktlrefvhfdetnndqga
  iirvkakelvsllrdderlkqeranakknkryrsy
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5uccA (A:)
  yssaqrvvrnatsndptgpttfdmeeissftyqsqtefmevmdmldrrlndkgknwrhva
  ksltvldylvrygsdkcvlwakdnlyiiktlrefvhfdetnndqgaiirvkakelvsllr
  dderlkqeranakkn