PDB entry 5uc9

View 5uc9 on RCSB PDB site
Description: Crystal structure of human Heme Oxygenase-2 in complex with Myristate
Class: oxidoreductase
Keywords: heme oxygenase, myristic acid, OXIDOREDUCTASE
Deposited on 2016-12-22, released 2017-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX2, HO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uc9a_
  • Chain 'B':
    Compound: Heme oxygenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX2, HO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uc9b_
  • Chain 'C':
    Compound: Heme oxygenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX2, HO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uc9c_
  • Chain 'D':
    Compound: Heme oxygenase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX2, HO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uc9d_
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uc9A (A:)
    mgsshhhhhhssgmadlsellkegtkeahdraentqfvkdflkgnikkelfklattalyf
    tysaleeemernkdhpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyve
    rihyigqnepellvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaq
    qfkqlyrarmnaldlnmktkeriveeankafeynmqifneldqags
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uc9A (A:)
    adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
    hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
    ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
    lnmktkeriveeankafeynmqifneldq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uc9B (B:)
    mgsshhhhhhssgmadlsellkegtkeahdraentqfvkdflkgnikkelfklattalyf
    tysaleeemernkdhpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyve
    rihyigqnepellvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaq
    qfkqlyrarmnaldlnmktkeriveeankafeynmqifneldqags
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uc9B (B:)
    madlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernk
    dhpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepell
    vahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnal
    dlnmktkeriveeankafeynmqifneldqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uc9C (C:)
    mgsshhhhhhssgmadlsellkegtkeahdraentqfvkdflkgnikkelfklattalyf
    tysaleeemernkdhpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyve
    rihyigqnepellvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaq
    qfkqlyrarmnaldlnmktkeriveeankafeynmqifneldqags
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uc9C (C:)
    adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
    hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
    ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
    lnmktkeriveeankafeynmqifneldqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uc9D (D:)
    mgsshhhhhhssgmadlsellkegtkeahdraentqfvkdflkgnikkelfklattalyf
    tysaleeemernkdhpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyve
    rihyigqnepellvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaq
    qfkqlyrarmnaldlnmktkeriveeankafeynmqifneldqags
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uc9D (D:)
    adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
    hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
    ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
    lnmktkeriveeankafeynmqifneldqa