PDB entry 5ub5

View 5ub5 on RCSB PDB site
Description: human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP
Class: transferase
Keywords: transferase, glycosyltransferase, GT-B glucosyltransferase
Deposited on 2016-12-20, released 2017-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein O-glucosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: POGLUT1, C3orf9, CLP46, KTELC1, MDSRP, MDS010, UNQ490/PRO1006
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NOTCH1, TAN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (2-41)
      • engineered mutation (8)
    Domains in SCOPe 2.08: d5ub5b_
  • Heterogens: NAG, UDP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5ub5B (B:)
gsdvnecvtnpcqndatcldqigefqcicmpgyegvhcevnt

    Sequence, based on observed residues (ATOM records): (download) 
    >5ub5B (B:)
dvnecvtnpcqndatcldqigefqcicmpgyegvhcevnt