PDB entry 5uat

View 5uat on RCSB PDB site
Description: Structure of human PYCR-1 complexed with NADPH
Class: oxidoreductase
Keywords: amino-acid biosynthesis, oxidoreductase, proline biosynthesis
Deposited on 2016-12-20, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroline-5-carboxylate reductase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PYCR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uata1, d5uata2
  • Chain 'B':
    Compound: Pyrroline-5-carboxylate reductase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PYCR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (22-End)
      • expression tag (16-21)
    Domains in SCOPe 2.06: d5uatb1, d5uatb2, d5uatb3
  • Chain 'C':
    Compound: Pyrroline-5-carboxylate reductase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PYCR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (22-End)
      • expression tag (18-21)
    Domains in SCOPe 2.06: d5uatc1, d5uatc2, d5uatc3
  • Chain 'D':
    Compound: Pyrroline-5-carboxylate reductase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PYCR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (22-End)
      • expression tag (16-21)
    Domains in SCOPe 2.06: d5uatd1, d5uatd2, d5uatd3
  • Chain 'E':
    Compound: Pyrroline-5-carboxylate reductase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PYCR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.06: d5uate1, d5uate2, d5uate3
  • Heterogens: SO4, NDP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uatA (A:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uatA (A:)
    msvgfilafalakgftaagvlaahkimastvsalrkmgvkltphnketvqhsdvlflavk
    phiipfildeigadiedrhivvscaagvtissiekklsafrpaprvircmtntpvvvreg
    atvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpayaftaldaladg
    gvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggatihalhvlesggfr
    sllinaveascirtrelqsmadq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uatB (B:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uatB (B:)
    nlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltp
    hnketvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpa
    prvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtgls
    gsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvssp
    ggatihalhvlesggfrsllinaveascirtrelqsmad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uatC (C:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uatC (C:)
    yfqsmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphn
    ketvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpapr
    vircmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgs
    gpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspgg
    atihalhvlesggfrsllinaveascirtrelqsmad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uatD (D:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uatD (D:)
    nlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltp
    hnketvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpa
    prvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtgls
    gsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvssp
    ggatihalhvlesggfrsllinaveascirtrelqsmad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5uatE (E:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uatE (E:)
    smsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnket
    vqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvir
    cmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpa
    yaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggati
    halhvlesggfrsllinaveascirtrelqsmadq