PDB entry 5u99

View 5u99 on RCSB PDB site
Description: Transition state analysis of adenosine triphosphate phosphoribosyltransferase
Class: transferase
Keywords: ATP-PRT, HisG, Adenosine triphosphate phosphoribosyltransferase, TRANSFERASE
Deposited on 2016-12-15, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: hisG, Rv2121c, MTCY261.17c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WMN1 (2-285)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5u99a1, d5u99a2, d5u99a3
  • Heterogens: SO4, MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u99A (A:)
    gamlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvg
    sgeldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypn
    lvrkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdse
    avlieragtdgqdqteardqlvarvqgvvfgqqylmldydcprsalkkataitpglespt
    iapladpdwvairalvprrdvngimdelaaigakailasdirfcrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u99A (A:)
    gamlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvg
    sgeldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypn
    lvrkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdse
    avlieraqteardqlvarvqgvvfgqqylmldydcprsalkkataitpglesptiapdpd
    wvairalvprrdvngimdelaaigakailasdirfcrf