PDB entry 5u8j

View 5u8j on RCSB PDB site
Description: Crystal structure of a protein of unknown function ECL_02571 involved in membrane biogenesis from Enterobacter cloacae
Class: unknown function
Keywords: unknown function, membrane biogenesis, alpha/beta protein, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2016-12-14, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0502 protein BFJ73_07745
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u8ja1, d5u8ja2
  • Chain 'B':
    Compound: UPF0502 protein BFJ73_07745
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u8jb1, d5u8jb2
  • Chain 'C':
    Compound: UPF0502 protein BFJ73_07745
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u8jc1, d5u8jc2
  • Chain 'D':
    Compound: UPF0502 protein BFJ73_07745
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BFJ73_07745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u8jd1, d5u8jd2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u8jA (A:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtr
    asrmhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgevdtst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8jA (A:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtr
    asrmhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u8jB (B:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtr
    asrmhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgevdtst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8jB (B:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsgrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtrasr
    mhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgevdt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u8jC (C:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtr
    asrmhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgevdtst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8jC (C:)
    kyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdilde
    lvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtra
    srmhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgevd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u8jD (D:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsgfgnrvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtr
    asrmhefadmqeveqtldglatredgpyvvrlarepgkresrymhlfsgevdtst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8jD (D:)
    mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
    elvkrhylrtvsvtkyeqrfcnsefgdlklsaaevavittlllrgaqtpgelrtrasrmh
    efadmqeveqtldglatredgpyvvrlasrymhlfsgev