PDB entry 5u7n

View 5u7n on RCSB PDB site
Description: crystal structure of a chimeric cua domain (subunit II) of cytochrome ba3 from thermus thermophilus with the amicyanin loop
Class: oxidoreductase
Keywords: oxidoreductase, electron transport
Deposited on 2016-12-12, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7na_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7nb_
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7nc_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7nd_
  • Chain 'E':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7ne_
  • Chain 'F':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7nf_
  • Chain 'G':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7ng_
  • Chain 'H':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98052 (Start-109)
      • linker (110-114)
    • Uniprot P98052 (115-123)
    Domains in SCOPe 2.07: d5u7nh_
  • Heterogens: CU, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u7nA (A:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nA (A:)
    klervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkit
    spdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u7nB (B:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nB (B:)
    gklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfki
    tspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u7nC (C:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nC (C:)
    gklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfki
    tspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u7nD (D:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nD (D:)
    lervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkits
    pdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5u7nE (E:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nE (E:)
    ervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitsp
    dvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5u7nF (F:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nF (F:)
    pttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvih
    gfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5u7nG (G:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nG (G:)
    vdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdv
    ihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5u7nH (H:)
    gshmvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpq
    gaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgti
    vvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u7nH (H:)
    lervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkits
    pdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke