PDB entry 5u79

View 5u79 on RCSB PDB site
Description: Crystal structure of a complex formed between MerB and Dimethyltin
Class: lyase,metal binding protein
Keywords: Bacterial Proteins, Cysteine, Escherichia coli, Lyases, Mercury, Dimethyltin, LYASE, METAL BINDING PROTEIN
Deposited on 2016-12-12, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylmercury lyase
    Species: Escherichia coli [TaxId:562]
    Gene: MERB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u79a1, d5u79a2
  • Chain 'B':
    Compound: Alkylmercury lyase
    Species: Escherichia coli [TaxId:562]
    Gene: MERB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u79b1, d5u79b2
  • Heterogens: ZN5, BR, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u79A (A:)
    mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
    tsteydkdgniigygltlretsyvfeiddrrlyawcaldtlifpaligrtarvsshcaat
    gapvsltvspseiqavepagmavslvlpqeaadvrqsfcchvhffasvptaedwaskhqg
    leglaivsvheafglgqefnrhllqtmssrtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u79A (A:)
    mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
    tsteydkdgniigygltlretsyvfeiddrrlyawcaldtlifpaligrtarvsshcaat
    gapvsltvspseiqavepagmavslvlpqeaadvrqsfcchvhffasvptaedwaskhqg
    leglaivsvheafglgqefnrhllqtms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u79B (B:)
    mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
    tsteydkdgniigygltlretsyvfeiddrrlyawcaldtlifpaligrtarvsshcaat
    gapvsltvspseiqavepagmavslvlpqeaadvrqsfcchvhffasvptaedwaskhqg
    leglaivsvheafglgqefnrhllqtmssrtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u79B (B:)
    mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
    tsteydkdgniigygltlretsyvfeiddrrlyawcaldtlifpaligrtarvsshcaat
    gapvsltvspseiqavepagmavslvlpqeaadvrqsfcchvhffasvptaedwaskhqg
    leglaivsvheafglgqefnrhllqtms