PDB entry 5u64

View 5u64 on RCSB PDB site
Description: Camel nanobody VHH-28
Class: immune system
Keywords: neutralizing antibody, camel vhh nanobody, HIV-1, IMMUNE SYSTEM
Deposited on 2016-12-07, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: vhh-28
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5U64
    Domains in SCOPe 2.07: d5u64b1, d5u64b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u64B (B:)
    madvqlqesgggsvqaggslrlscvasgvtstrpcigwfrqapgkeregvavvnfrgdst
    yitdsvkgrftisrdedsdtvylqmnslkpedtatyycaadvnrggfcyiedwyfsywgq
    gtqvtvssaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u64B (B:)
    dvqlqesgggsvqaggslrlscvasgvtstrpcigwfrqakeregvavvnfrgdstyitd
    svkgrftisrddtvylqmnslkpedtatyycaadvnrggfcyiedwyfsywgqgtqvtvs
    saaahhh