PDB entry 5u52

View 5u52 on RCSB PDB site
Description: 2 helix minimized version of the B-domain from Protein A (Z34C0 bound to IgG1 Fc (monoclinic form)
Class: immune system
Keywords: 2 helix bundle, Protein A, B-domain, IgG1 fc, IMMUNE SYSTEM
Deposited on 2016-12-06, released 2017-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: IgG1 fc
  Species: Homo sapiens [TaxId:9606]
  Gene: DKFZp686C11235
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6MZV7 (Start-208)
• Chain 'B':
  Compound: IgG1 fc
  Species: Homo sapiens [TaxId:9606]
  Gene: DKFZp686C11235
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6MZV7 (1-208)
    • expression tag (0)
• Chain 'E':
  Compound: Mini Z domain
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • PDB 5U52 (0-33)
  Domains in SCOPe 2.06: d5u52e_
• Chain 'Z':
  Compound: Mini Z domain
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • PDB 5U52 (0-33)
  Domains in SCOPe 2.06: d5u52z_
• Heterogens: NAG, MAN, GAL, FUC, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5u52E (E:)
  fnmqcqrrfyealhdpnlneeqrnakiksirddc
  

  
  
• Chain 'Z':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5u52Z (Z:)
  fnmqcqrrfyealhdpnlneeqrnakiksirddc