PDB entry 5u4p

View 5u4p on RCSB PDB site
Description: Protein-protein complex between 26S proteasome regulatory subunit RPN8, RPN11, and Ubiquitin S31
Class: protein binding
Keywords: Complex, Ubiquitin, Proteasome, PROTEIN BINDING
Deposited on 2016-12-05, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26s proteasome regulatory subunit rpn8
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: RPN8, YOR261C, O5360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u4pa_
  • Chain 'B':
    Compound: 26s proteasome regulatory subunit rpn11
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: RPN11, MPR1, YFR004W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ubiquitin-40S ribosomal protein S31
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: RPS31, RPS37, UBI3, YLR167W, L9470.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u4pc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u4pA (A:)
    mslqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeede
    knsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpll
    livdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u4pC (C:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg