PDB entry 5u4k

View 5u4k on RCSB PDB site
Description: NMR structure of the complex between the KIX domain of CBP and the transactivation domain 1 of p65
Class: transcription
Keywords: Transcription, p300-CBP coactivator family, NF-KB, transactivation domain
Deposited on 2016-12-05, released 2017-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: creb-binding protein
  Species: Mus musculus [TaxId:10090]
  Gene: Crebbp
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0U1RPQ3 (0-86)
  Domains in SCOPe 2.08: d5u4ka_
• Chain 'B':
  Compound: Transcription factor p65
  Species: Homo sapiens [TaxId:9606]
  Gene: Rela, Nfkb3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q04206 (2-32)
    • expression tag (0-1)
    • engineered mutation (4)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5u4kA (A:)
  gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
  rdeyyhllaekiykiqkeleekrrsrl
  

  
  
• Chain 'B':
  No sequence available.