PDB entry 5u45

View 5u45 on RCSB PDB site
Description: Human PPARdelta ligand-binding domain in complexed with specific agonist 14
Class: protein binding/activator
Keywords: PPARdelta, ligand-binding domain, agonist, protein binding-activator complex
Deposited on 2016-12-03, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u45a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u45b_
  • Heterogens: B7G, 7SY, PEG, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u45A (A:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
    qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
    ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
    lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
    vtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u45A (A:)
    dlkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvwkqlvnglppyk
    eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
    kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
    drpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqr
    ikktetetslhpllqeiykdmy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u45B (B:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
    qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
    ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
    lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
    vtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u45B (B:)
    adlkafskhiynaylknfnmtkkkarsiltgkhtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykd