PDB entry 5u43

View 5u43 on RCSB PDB site
Description: Human PPARdelta ligand-binding domain in complexed with specific agonist 12
Class: protein binding/activator
Keywords: PPARdelta, ligand-binding domain, agonist, PROTEIN BINDING-ACTIVATOR complex
Deposited on 2016-12-03, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u43a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u43b_
  • Heterogens: 7SS, PGO, PEG, B7G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u43A (A:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
    qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
    ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
    lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
    vtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u43A (A:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkapfvihdietlwqaekglvwkqlvn
    glppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifam
    lasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfia
    aiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteh
    aqmmqrikktetetslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u43B (B:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
    qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
    ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
    lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
    vtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u43B (B:)
    dlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwkqlvnglppy
    keisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasiv
    nkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilc
    gdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmq
    rikktetetslhpllqeiykdm