PDB entry 5u3f

View 5u3f on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis IlvE, a branched-chain amino acid transaminase, in complex with D-cycloserine derivative
Class: transferase
Keywords: branched-chain amino acid transaminase, amino acid biosynthesis, Pyridoxal phosphate, inhibitor, D-cycloserine, TRANSFERASE
Deposited on 2016-12-02, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: ilvE, Rv2210c, MTCY190.21c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u3fa_
  • Chain 'B':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: ilvE, Rv2210c, MTCY190.21c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u3fb_
  • Heterogens: 7TS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u3fA (A:)
    mtsgslqftvlravnpatdaqresmlrepgfgkyhtdhmvsidyaegrgwhnarvipygp
    ieldpsaivlhyaqevfeglkayrwadgsivsfradanaarlrssarrlaipelpdavfi
    eslrqliavdkawvpgaggeealylrpfifatepglgvrpatqyrylliaspagayfkgg
    iapvsvwvsteyvracpggtgaakfggnyaasllaqaeaaengcdqvvwldaverryiee
    mggmniffvlgsggsarlvtpelsgsllpgitrdsllqlaidagfaveerrididewqkk
    aaageitevfacgtaavitpvarvrhgasefriadgqpgevtmalrdtltgiqrgtfadt
    hgwmarlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u3fA (A:)
    htdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsfr
    adanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifatep
    glgvrpatqyrylliaspaapvsvwvsteyvracpggtgaakfggnyaasllaqaeaaen
    gcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitrdsllqlaid
    agfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefriadgqpgevt
    malrdtltgiqrgtfadthgwmarlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u3fB (B:)
    mtsgslqftvlravnpatdaqresmlrepgfgkyhtdhmvsidyaegrgwhnarvipygp
    ieldpsaivlhyaqevfeglkayrwadgsivsfradanaarlrssarrlaipelpdavfi
    eslrqliavdkawvpgaggeealylrpfifatepglgvrpatqyrylliaspagayfkgg
    iapvsvwvsteyvracpggtgaakfggnyaasllaqaeaaengcdqvvwldaverryiee
    mggmniffvlgsggsarlvtpelsgsllpgitrdsllqlaidagfaveerrididewqkk
    aaageitevfacgtaavitpvarvrhgasefriadgqpgevtmalrdtltgiqrgtfadt
    hgwmarlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u3fB (B:)
    yhtdhmvsidyaegrgwhnarvipygpieldpsaivlhyaqevfeglkayrwadgsivsf
    radanaarlrssarrlaipelpdavfieslrqliavdkawvpgaggeealylrpfifate
    pglgvrpatqyrylliaspaiapvsvwvsteyvracpggtgaakfggnyaasllaqaeaa
    engcdqvvwldaverryieemggmniffvlgsggsarlvtpelsgsllpgitrdsllqla
    idagfaveerrididewqkkaaageitevfacgtaavitpvarvrhgasefriadgqpge
    vtmalrdtltgiqrgtfadthgwmarlg