PDB entry 5u36

View 5u36 on RCSB PDB site
Description: Crystal Structure Of A Mutant M. Jannashii Tyrosyl-tRNA Synthetase
Class: ligase
Keywords: tyrosine phosphorylation, LIGASE
Deposited on 2016-12-01, released 2017-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (157)
      • engineered mutation (161)
      • expression tag (306)
    Domains in SCOPe 2.06: d5u36a1, d5u36a2
  • Chain 'B':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (Start-305)
      • engineered mutation (31)
      • engineered mutation (64)
      • engineered mutation (157)
      • engineered mutation (161)
      • expression tag (306)
    Domains in SCOPe 2.06: d5u36b1, d5u36b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u36A (A:)
    mdefemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
    diiialadlhaylnqkgeldeirkigdynkkvfeamglkakyvygsekhldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvngihykgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u36A (A:)
    defemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagfd
    iiialadlhayeldeirkigdynkkvfeamglkakyvygsldkdytlnvyrlalkttlkr
    arrsmeliarpkvaeviypimqvngihykgvdvavggmeqrkihmlarellpkkvvcihn
    pvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpimeiakyfleypl
    tikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u36B (B:)
    mdefemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagf
    diiialadlhaylnqkgeldeirkigdynkkvfeamglkakyvygsekhldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvngihykgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u36B (B:)
    defemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagfd
    iiialadlhayeldeirkigdynkkvfeamglkakyvygsldkdytlnvyrlalkttlkr
    arrsmeliarpkvaeviypimqvngihykgvdvavggmeqrkihmlarellpkkvvcihn
    pvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpimeiakyfleypl
    tikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrll