PDB entry 5u20

View 5u20 on RCSB PDB site
Description: X-ray structure of the WlaRG aminotransferase from Campylobacter jejuni, internal PLP-aldimine
Class: transferase
Keywords: aminotransferase lipooligosaccharide pyridoxal 5'-phosphate, TRANSFERASE
Deposited on 2016-11-29, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.06: d5u20a1, d5u20a2
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.06: d5u20b1, d5u20b2
  • Chain 'C':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.06: d5u20c1, d5u20c2
  • Chain 'D':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.06: d5u20d1, d5u20d2
  • Heterogens: NA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u20A (A:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u20A (A:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u20B (B:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u20B (B:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u20C (C:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u20C (C:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u20D (D:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u20D (D:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk