PDB entry 5u1b

View 5u1b on RCSB PDB site
Description: Ferritin with Gc MtrE loop2 inserted at the N-terminus
Class: oxidoreductase
Keywords: chimera, nanoparticle, 24mer cage, immunogen, OXIDOREDUCTASE
Deposited on 2016-11-28, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51006
      • linker (20-21)
    • Uniprot O69434 (22-End)
      • conflict (146)
    Domains in SCOPe 2.06: d5u1ba_
  • Chain 'B':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u1bb_
  • Chain 'C':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u1bc_
  • Chain 'D':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u1bd_
  • Chain 'E':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u1be_
  • Chain 'F':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u1bf_
  • Chain 'G':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u1bg_
  • Chain 'H':
    Compound: MtrE protein,Ferritin chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: pfr, AB991_00330, ACM31_07775, AEY53_00945
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51006
      • linker (20-21)
    • Uniprot O69434 (22-End)
      • conflict (146)
    Domains in SCOPe 2.06: d5u1bh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u1bA (A:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bA (A:)
    dhmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkli
    vflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfn
    flqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u1bB (B:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bB (B:)
    mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
    lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
    qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u1bC (C:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bC (C:)
    mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
    lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
    qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u1bD (D:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bD (D:)
    mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
    lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
    qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5u1bE (E:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bE (E:)
    mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
    lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
    qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5u1bF (F:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bF (F:)
    mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
    lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
    qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5u1bG (G:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bG (G:)
    mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakklivf
    lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
    qwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5u1bH (H:)
    marctgsvelgglfksgtgcdhmlskdiikllneqvnkemnssnlymsmsswcythsldg
    aglflfdhaaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhis
    esinnivdhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyv
    kgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1bH (H:)
    dhmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkli
    vflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfn
    flqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk