PDB entry 5u1a

View 5u1a on RCSB PDB site
Description: Ferritin with Gc MtrE loop 1 inserted at His34
Class: oxidoreductase
Keywords: chimera, nanoparticle, 24mer cage, immunogen, OXIDOREDUCTASE
Deposited on 2016-11-28, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (0-33)
      • conflict (33)
    • Uniprot Q51006 (34-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
    Domains in SCOPe 2.06: d5u1aa_
  • Chain 'B':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'C':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (0-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-181)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'D':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (34-48)
    • Uniprot A0A0B2EHC8 (49-181)
      • conflict (53)
      • conflict (55)
      • conflict (139)
    Domains in SCOPe 2.06: d5u1ad_
  • Chain 'E':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'F':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (0-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'G':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (0-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'H':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (34-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
    Domains in SCOPe 2.06: d5u1ah_
  • Chain 'I':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (0-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-181)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'J':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (34-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
    Domains in SCOPe 2.06: d5u1aj_
  • Chain 'K':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Chain 'L':
    Compound: Ferritin,MtrE protein chimera
    Species: Helicobacter pylori [TaxId:210]
    Gene: AM498_04815, HPY173_00920, HPY207_01135, OA23_03490
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B2EHC8 (Start-33)
      • conflict (33)
    • Uniprot Q51006 (Start-48)
    • Uniprot A0A0B2EHC8 (49-End)
      • conflict (53)
      • conflict (55)
      • conflict (139)
  • Heterogens: NA, FE, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u1aA (A:)
    mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
    haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
    dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
    ks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1aA (A:)
    mlskdiikllneqvnkemnssnlymsmsswcytgssysldgcgtflfdhaaeeyehakkl
    ivflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatf
    nflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u1aD (D:)
    mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
    haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
    dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
    ks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1aD (D:)
    lskdiikllneqvnkemnssnlymsmsswcytgsrysldgcgtflfdhaaeeyehakkli
    vflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfn
    flqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5u1aH (H:)
    mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
    haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
    dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
    ks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1aH (H:)
    lskdiikllneqvnkemnssnlymsmsswcytgsysldgcgtflfdhaaeeyehakkliv
    flnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnf
    lqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5u1aJ (J:)
    mlskdiikllneqvnkemnssnlymsmsswcytgsrqgslsggnvsssysldgcgtflfd
    haaeeyehakklivflnennvpvqltsisapehkfegltqifqkayeheqhisesinniv
    dhaikskdhatfnflqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksr
    ks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1aJ (J:)
    lskdiikllneqvnkemnssnlymsmsswcytgssysldgcgtflfdhaaeeyehakkli
    vflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfn
    flqwyvseqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.