PDB entry 5u0m

View 5u0m on RCSB PDB site
Description: Fatty aldehyde dehydrogenase from Marinobacter aquaeolei VT8 and cofactor complex
Class: oxidoreductase
Keywords: Dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-11-24, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-succinylglutamate 5-semialdehyde dehydrogenase
    Species: Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) [TaxId:351348]
    Gene: astD, Maqu_3316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u0ma_
  • Chain 'B':
    Compound: N-succinylglutamate 5-semialdehyde dehydrogenase
    Species: Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) [TaxId:351348]
    Gene: astD, Maqu_3316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u0mb_
  • Heterogens: EDO, CIT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u0mA (A:)
    mhhhhhhanltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearka
    flawrrkslaerqavieafgelleankeelahqigletgkplwesrtevaammgkipisv
    kaynertghtesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkp
    seltpgvaeltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllh
    eqfggqpekilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgk
    kgdeflarlvevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemk
    qlkpdtgllspgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsd
    drklynrlveevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasle
    agkselpdslapglnfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u0mA (A:)
    nltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearkaflawrrks
    laerqavieafgelleankeelahqigletgkplwesrtevaammgkipisvkaynertg
    htesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkpseltpgva
    eltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllheqfggqpe
    kilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgkkgdeflar
    lvevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemkqlkpdtgl
    lspgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsddrklynrl
    veevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasleagkselpd
    slapglnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u0mB (B:)
    mhhhhhhanltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearka
    flawrrkslaerqavieafgelleankeelahqigletgkplwesrtevaammgkipisv
    kaynertghtesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkp
    seltpgvaeltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllh
    eqfggqpekilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgk
    kgdeflarlvevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemk
    qlkpdtgllspgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsd
    drklynrlveevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasle
    agkselpdslapglnfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u0mB (B:)
    ltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearkaflawrrksl
    aerqavieafgelleankeelahqigletgkplwesrtevaammgkipisvkaynertgh
    tesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkpseltpgvae
    ltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllheqfggqpek
    ilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgkkgdeflarl
    vevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemkqlkpdtgll
    spgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsddrklynrlv
    eevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasleagkselpds
    lapglnf