PDB entry 5u0l

View 5u0l on RCSB PDB site
Description: X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from Marinobacter aquaeolei VT8 complexed with a substrate
Class: oxidoreductase
Keywords: Dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-11-24, released 2017-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-succinylglutamate 5-semialdehyde dehydrogenase
    Species: Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) [TaxId:351348]
    Gene: astD, Maqu_3316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u0la_
  • Chain 'B':
    Compound: N-succinylglutamate 5-semialdehyde dehydrogenase
    Species: Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) [TaxId:351348]
    Gene: astD, Maqu_3316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u0lb_
  • Heterogens: EDO, 8YP, MPD, CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u0lA (A:)
    mhhhhhhanltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearka
    flawrrkslaerqavieafgelleankeelahqigletgkplwesrtevaammgkipisv
    kaynertghtesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkp
    seltpgvaeltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllh
    eqfggqpekilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgk
    kgdeflarlvevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemk
    qlkpdtgllspgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsd
    drklynrlveevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasle
    agkselpdslapglnfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u0lA (A:)
    nltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearkaflawrrks
    laerqavieafgelleankeelahqigletgkplwesrtevaammgkipisvkaynertg
    htesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkpseltpgva
    eltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllheqfggqpe
    kilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgkkgdeflar
    lvevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemkqlkpdtgl
    lspgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsddrklynrl
    veevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasleagkselpd
    slapglnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u0lB (B:)
    mhhhhhhanltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearka
    flawrrkslaerqavieafgelleankeelahqigletgkplwesrtevaammgkipisv
    kaynertghtesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkp
    seltpgvaeltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllh
    eqfggqpekilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgk
    kgdeflarlvevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemk
    qlkpdtgllspgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsd
    drklynrlveevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasle
    agkselpdslapglnfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u0lB (B:)
    ltgnvyidglwlpghgapfesvqpvtgetvwdgnaasledvdaavrearkaflawrrksl
    aerqavieafgelleankeelahqigletgkplwesrtevaammgkipisvkaynertgh
    tesdvagghavlrhrphgvvavfgpynfpghlpnghivpallagntvvfkpseltpgvae
    ltvrlwekaglpdgvinlvqggsdtgkclarhslidglfftgsstvghllheqfggqpek
    ilalemggnnplivqnvsdldgavhhalqsaflsagqrctcarrllvpkgkkgdeflarl
    vevaaritvaefdadpqpfmgsvisaeaanqllkaqaamlekgatsllemkqlkpdtgll
    spgivdatgieledqeffgplltvyrykgfdealelanntryglsagilsddrklynrlv
    eevragivnwnrpltgassaapfggvgasgnhrpsayyaadycawpmasleagkselpds
    lapglnf