PDB entry 5u08

View 5u08 on RCSB PDB site
Description: Crystal structure of an aminoglycoside acetyltransferase ENV0020 from an uncultured soil metagenomic sample in complex with sisomicin
Class: transferase/antibiotic
Keywords: GNAT fold, GCN5-N-acetyltransferase fold, acetyltransferase, aminoglycoside, sisomicin, antibiotic resistance, metagenome, soil, coenzyme A, structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE-ANTIBIOTIC complex
Deposited on 2016-11-23, released 2017-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aac3-I
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059WZ16 (Start-156)
      • engineered mutation (137)
    Domains in SCOPe 2.06: d5u08a_
  • Chain 'B':
    Compound: aac3-I
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059WZ16 (Start-156)
      • engineered mutation (137)
    Domains in SCOPe 2.06: d5u08b_
  • Chain 'C':
    Compound: aac3-I
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059WZ16 (Start-156)
      • engineered mutation (137)
    Domains in SCOPe 2.06: d5u08c_
  • Chain 'D':
    Compound: aac3-I
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059WZ16 (Start-156)
      • engineered mutation (137)
    Domains in SCOPe 2.06: d5u08d_
  • Heterogens: SIS, MG, ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u08A (A:)
    mgqnmeidnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvf
    vallenkivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgf
    eevfvqadkvddyaldfarstkptaeeqvvhfyytlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u08A (A:)
    eidnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvalle
    nkivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfv
    qadkvddyaldfarstkptaeeqvvhfyytlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u08B (B:)
    mgqnmeidnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvf
    vallenkivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgf
    eevfvqadkvddyaldfarstkptaeeqvvhfyytlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u08B (B:)
    dnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenk
    ivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqa
    dkvddyaldfarstkptaeeqvvhfyytlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u08C (C:)
    mgqnmeidnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvf
    vallenkivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgf
    eevfvqadkvddyaldfarstkptaeeqvvhfyytlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u08C (C:)
    dnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenk
    ivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqa
    dkvddyaldfarstkptaeeqvvhfyytlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u08D (D:)
    mgqnmeidnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvf
    vallenkivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgf
    eevfvqadkvddyaldfarstkptaeeqvvhfyytlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u08D (D:)
    nflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenki
    vggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqad
    kvddyaldfarstkptaeeqvvhfyytlk