PDB entry 5ty0

View 5ty0 on RCSB PDB site
Description: 2.22 Angstrom Crystal Structure of N-terminal Fragment (residues 1-419) of Elongation Factor G from Legionella pneumophila.
Class: Lipid-Binding Protein
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, elongation factor G, Lipid-Binding Protein
Deposited on 2016-11-17, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: fusA, lpg0326
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty0a1, d5ty0a2
  • Heterogens: NA, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ty0A (A:)
    snamatplklyrnigiaahvdagkttttervlyytgmshkigevhdgaatmdwmvqeqer
    gititsaattcywsgmdkqfeshriniidtpghvdfmieverslrvldgavvvfdsvagv
    epqsetvwrqankygvprivfvnkmdrmganflrvvsqikqrlgstpvvlqlpigaeeef
    kgvidlikmkaihwdeenkgmtfkyvdipadlkstceeyrahiieaaaeyseelmekyle
    geefteaeikkalrhltitnkvvpvfcgsafknkgvqavldgvieylpsptdipdiqgvd
    ehgdvihrktsydepfsalafkiatdpfvgtltyfraysgilksgdtvynsvkgkkerig
    rllqmhansreeikevragdiaaavglktvttgdtlcdqdkvvilermdfpdpviavave
    pk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty0A (A:)
    atplklyrnigiaahvdagkttttervlyytgmshtsaattcywsgmdkqfeshriniid
    tpghvdfmieverslrvldgavvvfdsvagvepqsetvwrqankygvprivfvnkmdrmg
    anflrvvsqikqrlgstpvvlqlpigaeeefkgvidlikmkaihwdeenkgmtfkyvdip
    adlkstceeyrahiieaaaeyseelmekylegeefteaeikkalrhltitnkvvpvfcgs
    afknkgvqavldgvieylpsptdipdiqgvdehgdvihrktsydepfsalafkiatdpfv
    gtltyfraysgilksgdtvynsvkgkkerigrllqmhansreeikevragdiaaavglkt
    vttgdtlcdqdkvviler