PDB entry 5txi

View 5txi on RCSB PDB site
Description: Crystal structure of wild-type S. aureus penicillin binding protein 4 (PBP4) in complex with ceftobiprole
Class: HYDROLASE / Antibiotic
Keywords: HYDROLASE, Antibiotic, HYDROLASE - Antibiotic complex
Deposited on 2016-11-16, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin binding protein 4
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5txia1, d5txia2
  • Chain 'B':
    Compound: penicillin binding protein 4
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5txib1, d5txib2
  • Heterogens: RB6, SO4, ZN, CL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5txiA (A:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5txiB (B:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq