PDB entry 5twe

View 5twe on RCSB PDB site
Description: CTX-M-14 P167S:S70G mutant enzyme crystallized with ceftazidime
Class: hydrolase/antibiotic
Keywords: CTX-M beta-lactamase ceftazidime, HYDROLASE-ANTIBIOTIC complex
Deposited on 2016-11-12, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14, beta-lactamase CTX-M-14, bla-CTX-M-14a, blaCTX-M-14a, blaCTX-M-14b, blaCTX-M-14c, blaCTX-M-27b, blatoho-3, blaUOE-2, CTX-M-14, AN206_26770, APT94_14605, BJJ90_27545, BK334_27290, ETN48_p0088, pCT_085, pHK01_011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L5C7 (Start-262)
      • engineered mutation (44)
      • engineered mutation (141)
    Domains in SCOPe 2.06: d5twea_
  • Heterogens: CAZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tweA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrtestlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tweA (A:)
    tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqset
    qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
    gvtafaraigdetfrldrtestlntaipgdprdtttpramaqtlrqltlghalgetqraq
    lvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqp
    qqnaesrrdvlasaariiaegl