PDB entry 5tw8

View 5tw8 on RCSB PDB site
Description: Crystal structure of wild-type S. aureus penicillin binding protein 4 (PBP4) in complex with ceftaroline
Class: HYDROLASE / Antibiotic
Keywords: Hydrolase, Penicillin binding protein, beta-lactam antibiotics, HYDROLASE - Antibiotic complex
Deposited on 2016-11-11, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 4
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: pbp4, SACOL0699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw8a1, d5tw8a2
  • Chain 'B':
    Compound: Penicillin-binding protein 4
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: pbp4, SACOL0699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tw8b1, d5tw8b2
  • Heterogens: AI8, ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tw8A (A:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tw8A (A:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdykggekqrnmmgnalmersfdqykyvkilskgeq
    ringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tw8B (B:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhq