PDB entry 5tvg

View 5tvg on RCSB PDB site
Description: Crystal structure of an alpha,alpha-trehalose-phosphate synthase (UDP-forming) from Burkholderia vietnamiensis
Class: transferase
Keywords: structural genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2016-11-08, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JGS8 (8-End)
      • expression tag (3-7)
    Domains in SCOPe 2.07: d5tvga1, d5tvga2
  • Chain 'B':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JGS8 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5tvgb1, d5tvgb2
  • Chain 'C':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvgc_
  • Chain 'D':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JGS8 (8-End)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d5tvgd1, d5tvgd2
  • Chain 'E':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvge_
  • Chain 'F':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvgf_
  • Chain 'G':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvgg_
  • Chain 'H':
    Compound: Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvgh_
  • Heterogens: UDP, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tvgA (A:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgA (A:)
    hhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpdaapa
    vrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamla
    rqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelv
    kfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypdaia
    eaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsf
    vqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffrmsq
    vgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadal
    aralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tvgB (B:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgB (B:)
    hmsrlivvsnrvagglavgvmdalkqtggvwfgwngeivgtpdaapavrrdgnvtyatlg
    ltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaallrpddli
    wvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmcaydiagfqt
    dadkrafsdyierrgigtasgmlhahgrvvkvaaypigvypdaiaeaavqyggrkpvkml
    rdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiapptrsdvqtyq
    riretlereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvtplrdgmnlva
    keyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadalaralamplaerqarh
    eenlaqlrnndlsvwrdtfvadlrsvaaaasvtq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tvgC (C:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgC (C:)
    msrlivvsnrvapsagglavgvmdalkqtggvwfgwngeivgtpdaapavrrdgnvtyat
    lgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaallrpdd
    liwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmcaydiagf
    qtdadkrafsdyierrgigtgmlhahgrvvkvaaypigvypdaiaeaavqyggrkpvkml
    rdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiapptrsdvqtyq
    riretlereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvtplrdgmnlva
    keyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadalaralamplaerqarh
    eenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tvgD (D:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgD (D:)
    hhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpdaapav
    rrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlar
    qlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvk
    fmcaydiagfqtdadkrafsdyierrgigtgmlhahgrvvkvaaypigvypdaiaeaavq
    yggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiap
    ptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvt
    plrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadalarala
    mplaerqarheenlaqlrnndlsvwrdtfvadlrsv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tvgE (E:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgE (E:)
    msrlivvsnrvatrpsagglavgvmdalkqtggvwfgwngeivgtpdaapavrrdgnvty
    atlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaallrp
    ddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmcaydia
    gfqtdadkrafsdyierrgigtmlhahgrvvkvaaypigvypdaiaeaavqyggrkpvkm
    lrdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiapptrsdvqty
    qriretlereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvtplrdgmnlv
    akeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadalaralamplaerqar
    heenlaqlrnndlsvwrdtfvadlrsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tvgF (F:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgF (F:)
    msrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpdaapavrrdg
    nvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaa
    llrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmca
    ydiagfqtdadkrafsdyierrgigtamlhahgrvvkvaaypigvypdaiaeaavqyggr
    kpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiapptrs
    dvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvtplrd
    gmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqmadalaralampla
    erqarheenlaqlrnndlsvwrdtfvadlrsvaaaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5tvgG (G:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgG (G:)
    srlivvsnrvagglavgvmdalkqtggvwfgwngetpdaapavrrdgnvtyatlgltrrd
    ydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaallrpddliwvhdy
    hllpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmcaydiagfqtdadkr
    afsdyierrgigtgmlhahgrvvkvaaypigvypdaiaeaavqyggrkpvkmlrdalggr
    klvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiapptrsdvqtyqriretle
    reagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvtplrdgmnlvakeyvasq
    dpadpgvlvlsefagaaaelggallvnpydhaqmadalaralamplaerqarheenlaql
    rnndlsvwrdtfvadlrsv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5tvgH (H:)
    mahhhhhhmsrlivvsnrvaagedtrpsagglavgvmdalkqtggvwfgwngeivgtpda
    apavrrdgnvtyatlgltrrdydqyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvna
    mlarqlaallrpddliwvhdyhllpfahclrelgvknpigfflhipfpspdmlrvvpphd
    elvkfmcaydiagfqtdadkrafsdyierrgigtasddgmlhahgrvvkvaaypigvypd
    aiaeaavqyggrkpvkmlrdalggrklvmsvdrldyskglverfqsfermlagapdwqgr
    vsfvqiapptrsdvqtyqriretlereagringrfaqldwtpiqylnrkyernllmaffr
    msqvgyvtplrdgmnlvakeyvasqdpadpgvlvlsefagaaaelggallvnpydhaqma
    dalaralamplaerqarheenlaqlrnndlsvwrdtfvadlrsvaaaasvtqragrrtah
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvgH (H:)
    srlivvsnlavgvmdalkqtggvwfgwngeivgtpdaapavrrdgnvtyatlgltrrdyd
    qyyrgfsnatlwpvfhyrsdlarfdrqeyagylrvnamlarqlaallrpddliwvhdyhl
    lpfahclrelgvknpigfflhipfpspdmlrvvpphdelvkfmcaydiagfqtdadkraf
    sdyierrgigtasddgmlhahgrvvkvaaypigvypdaiaeaavqyggrkpvkmlrdalg
    grklvmsvdrldyskglverfqsfermlagapdwqgrvsfvqiapptrsdvqtyqriret
    lereagringrfaqldwtpiqylnrkyernllmaffrmsqvgyvtplrdgmnlvakeyva
    sqdpadpgvlvlsefagaaaelggallvnpydhaqmadalaralamplaerqarheenla
    qlrnndlsvwrdtfvadlrsvaa