PDB entry 5tvc

View 5tvc on RCSB PDB site
Description: Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with (E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine (TI-5312)
Class: acetylcholine-binding protein
Keywords: nicotinic, acetylcholine, AChBP, chimeric protein, ACETYLCHOLINE-BINDING PROTEIN
Deposited on 2016-11-08, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA3, NACHRA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-189)
      • expression tag (6-8)
      • engineered mutation (63)
    • Uniprot P32297 (190-205)
    • Uniprot Q8WSF8 (206-End)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d5tvca1, d5tvca2
  • Chain 'B':
    Compound: Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA3, NACHRA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-189)
      • engineered mutation (63)
    • Uniprot P32297 (190-205)
    • Uniprot Q8WSF8 (206-End)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d5tvcb_
  • Chain 'C':
    Compound: Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA3, NACHRA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-189)
      • expression tag (5-8)
      • engineered mutation (63)
    • Uniprot P32297 (190-205)
    • Uniprot Q8WSF8 (206-End)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d5tvcc1, d5tvcc2
  • Chain 'D':
    Compound: Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA3, NACHRA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (Start-189)
      • engineered mutation (63)
    • Uniprot P32297 (190-205)
    • Uniprot Q8WSF8 (206-End)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d5tvcd_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA3, NACHRA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-189)
      • expression tag (3-8)
      • engineered mutation (63)
    • Uniprot P32297 (190-205)
    • Uniprot Q8WSF8 (206-End)
      • engineered mutation (207)
    Domains in SCOPe 2.07: d5tvce1, d5tvce2
  • Heterogens: SO4, 1PE, 7LB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tvcA (A:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqykhdikyncceeiypdvvlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvcA (A:)
    dklhsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwkl
    nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqy
    khdikyncceeiypdvvlvvkfrerragngf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tvcB (B:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqykhdikyncceeiypdvvlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvcB (B:)
    hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
    mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
    mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
    ikyncceeiypdvvlvvkfre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tvcC (C:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqykhdikyncceeiypdvvlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvcC (C:)
    ddklhsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk
    lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
    rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
    ykhdieeiypdvvlvvkfrer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tvcD (D:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqykhdikyncceeiypdvvlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvcD (D:)
    sqanlmrlksdlypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnslmw
    dpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsfmc
    dptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhdik
    yncceeiypdvvlvvkfre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tvcE (E:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqykhdikyncceeiypdvvlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvcE (E:)
    ddddklhsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqr
    wklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfip
    aqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsa
    tqykhdikyncceeiypdvvlvvkfrer