PDB entry 5tv2

View 5tv2 on RCSB PDB site
Description: Crystal structure of a fragment (1-405) of an elongation factor G from Vibrio vulnificus CMCP6
Class: nuclear protein
Keywords: GTP-binding domain, domain II, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE, NUCLEAR PROTEIN
Deposited on 2016-11-07, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Vibrio vulnificus [TaxId:216895]
    Gene: fusA, VV1_1338
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv2a1, d5tv2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tv2A (A:)
    marktpieryrnigicahvdagktttterilfytglshkigevhdgaatmdwmeqeqerg
    ititsaatttfwrgmeaqfqdhrvniidtpghvdftieverslrvldgavvvfcgssgve
    pqsetvwrqadkyhvprmvfvnkmdragadflrvvdqiknrlganpvpiqlnvgaeedfk
    gvidlikmkminwneadqgmtftyeeipadmielaeewrnnlveaaaeaseelmdkylee
    gelteaeikqalrartlnneivlatcgsafknkgvqavldavieylpspidvpaikgide
    ndneverhaddnepfsalafkiatdpfvgtltfirvysgvvntgdavynsvkqkkerfgr
    ivqmhankreeikevragdiaaaiglkdvttgdtlcnsdhkvile
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv2A (A:)
    marktpieryrnigicaktttterilfytglshtsaatttfwrgmeaqfqdhrvniidtp
    everslrvldgavvvfcgssgvsetvwrqadkyhvprmvfvnkmdragadflrvvdqikn
    rlganpvpiqlnvgaeedfkgvidlikmkminwneadqgmtftyeeipadmielaeewrn
    nlveaaaeaseelmdkyleegelteaeikqalrartlnneivlatcgsafknkgvqavld
    avieylpspidvpaikgidendneverhaddnepfsalafkiatdpfvgtltfirvysgv
    vntgdavynsvkqkkerfgrivqmhankreeikevragdiaaaiglkdvttgdtlcnsdh
    kvile