PDB entry 5ts2

View 5ts2 on RCSB PDB site
Description: Crystal structure of a phosphopantetheine adenylyltransferase (CoaD, PPAT) from Pseudomonas aeruginosa bound to dephospho coenzyme A
Class: transferase
Keywords: structural genomics, coenzyme A biosynthesis, PPAT, CoaD, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2016-10-27, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Pseudomonas aeruginosa (strain LESB58) [TaxId:557722]
    Gene: coaD, PLES_03601
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7V2S6 (8-End)
      • expression tag (1-7)
    Domains in SCOPe 2.07: d5ts2a1, d5ts2a2
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Pseudomonas aeruginosa (strain LESB58) [TaxId:557722]
    Gene: coaD, PLES_03601
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ts2b_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Pseudomonas aeruginosa (strain LESB58) [TaxId:557722]
    Gene: coaD, PLES_03601
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7V2S6 (8-End)
      • expression tag (1-7)
    Domains in SCOPe 2.07: d5ts2c1, d5ts2c2
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: Pseudomonas aeruginosa (strain LESB58) [TaxId:557722]
    Gene: coaD, PLES_03601
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7V2S6 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d5ts2d1, d5ts2d2
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: Pseudomonas aeruginosa (strain LESB58) [TaxId:557722]
    Gene: coaD, PLES_03601
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7V2S6 (8-End)
      • expression tag (1-7)
    Domains in SCOPe 2.07: d5ts2e1, d5ts2e2
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: Pseudomonas aeruginosa (strain LESB58) [TaxId:557722]
    Gene: coaD, PLES_03601
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7V2S6 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5ts2f1, d5ts2f2
  • Heterogens: COD, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ts2A (A:)
    mahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrva
    laqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdv
    esmfltpsekysfisstlvreiaalggdiskfvhpavadalaerfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ts2A (A:)
    ahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrval
    aqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdve
    smfltpsekysfisstlvreiaalggdiskfvhpavadalaerfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ts2B (B:)
    mahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrva
    laqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdv
    esmfltpsekysfisstlvreiaalggdiskfvhpavadalaerfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ts2B (B:)
    mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
    lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
    ekysfisstlvreiaalggdiskfvhpavadalaerfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ts2C (C:)
    mahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrva
    laqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdv
    esmfltpsekysfisstlvreiaalggdiskfvhpavadalaerfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ts2C (C:)
    ahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrval
    aqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdve
    smfltpsekysfisstlvreiaalggdiskfvhpavadalaerfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ts2D (D:)
    mahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrva
    laqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdv
    esmfltpsekysfisstlvreiaalggdiskfvhpavadalaerfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ts2D (D:)
    hhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevt
    khlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmflt
    psekysfisstlvreiaalggdiskfvhpavadalaerf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ts2E (E:)
    mahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrva
    laqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdv
    esmfltpsekysfisstlvreiaalggdiskfvhpavadalaerfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ts2E (E:)
    ahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrval
    aqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdve
    smfltpsekysfisstlvreiaalggdiskfvhpavadalaerfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ts2F (F:)
    mahhhhhhmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrva
    laqevtkhlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdv
    esmfltpsekysfisstlvreiaalggdiskfvhpavadalaerfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ts2F (F:)
    hmnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtk
    hlpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltp
    sekysfisstlvreiaalggdiskfvhpavadalaerfk