PDB entry 5trw

View 5trw on RCSB PDB site
Description: Crystal structure of Pyridoxamine kinase PDXY from Burkholderia xenovorans
Class: transferase
Keywords: SSGCID, Burkholderia xenovorans, Pyridoxal kinase, PdxY, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2016-10-27, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal kinase PdxY
    Species: Burkholderia xenovorans (strain LB400) [TaxId:266265]
    Gene: pdxY, Bxeno_A1503, Bxe_A2936
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trwa_
  • Heterogens: NO3, NHE, SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5trwA (A:)
    mahhhhhhmtknvlsiqshvvfghagnsaavfpmrrlgvnvwplntvqfsnhtqyghwtg
    gaidatqmvelvdgigaigmlprcdavlsgylgtpeqaqsvleivkavkaanprawyfcd
    pvmgavsgckvepgiqeflvrtmpgvadamapnhtelqrlvgreietleeavtacrelia
    rgpklvlvkhlldrnspadrfnmlvvtereawmgqrplypfarqpvgvgdltsavfvart
    llgdsiraafehtlaavnavvkatwqagryelelvaaqseiaqprewfdawvgdta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trwA (A:)
    mtknvlsiqshvvfghagnsaavfpmrrlgvnvwplntvqfsnhtqyghwtggaidatqm
    velvdgigaigmlprcdavlsgylgtpeqaqsvleivkavkaanprawyfcdpvmepgiq
    eflvrtmpgvadamapnhtelqrlvgreietleeavtacreliargpklvlvkhlldrns
    padrfnmlvvtereawmgqrplypfarqpvgvgdltsavfvartllgdsiraafehtlaa
    vnavvkatwqagryelelvaaqseiaqprewfdawvgd