PDB entry 5trr

View 5trr on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis proteasome in complex with N,C-capped dipeptide PKS2169
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: N, C-capped dipeptides, Mycobacterium tuberculosis, proteasome inhibitors, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2016-10-27, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trra_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrb_
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrc_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrd_
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trre_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrf_
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrh_
  • Chain 'I':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trri_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrj_
  • Chain 'K':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrk_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrl_
  • Chain 'M':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrm_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrn_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trro_
  • Chain 'P':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrq_
  • Chain 'R':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrr_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrs_
  • Chain 'T':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trrt_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trru_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrv_
  • Chain 'W':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrw_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrx_
  • Chain 'Y':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trry_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trrz_
  • Chain 'a':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 7HY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5trrA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragstlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5trrB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5trrC (C:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrC (C:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqallvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5trrD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5trrE (E:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrE (E:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragtlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5trrF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsgvaslevavldanrprrafrritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5trrG (G:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrG (G:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5trrH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5trrI (I:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrI (I:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5trrJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5trrK (K:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrK (K:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5trrL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5trrM (M:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrM (M:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5trrN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5trrO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragtlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5trrP (P:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrP (P:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragstlgvaslevavldanrprrafrritgsalqallvd
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5trrQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5trrR (R:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrR (R:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5trrS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragslgvaslevavldanrprrafrritgsalqallvd
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5trrT (T:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrT (T:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragtlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5trrU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5trrV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5trrW (W:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrW (W:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5trrX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5trrY (Y:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrY (Y:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5trrZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trrZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.