PDB entry 5trg

View 5trg on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis proteasome in complex with N,C-capped dipeptide DPLG-2
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: N, C-capped dipeptides, Mycobacterium tuberculosis, DPLG-2, proteasome inhibitors, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2016-10-26, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trga_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgb_
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgc_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgd_
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trge_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgf_
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgh_
  • Chain 'I':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgi_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgj_
  • Chain 'K':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgk_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgl_
  • Chain 'M':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgm_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgn_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgo_
  • Chain 'P':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgp_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgq_
  • Chain 'R':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgr_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgs_
  • Chain 'T':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgt_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcA, MRA_2124
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5U4D5 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5trgu_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgv_
  • Chain 'W':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgw_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgx_
  • Chain 'Y':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgy_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trgz_
  • Chain 'a':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: prcB, MRA_2125
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 7HJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5trgA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragstlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5trgB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5trgC (C:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgC (C:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5trgD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsgvaslevavldanrprrafrritgsalqallvdqespqs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5trgE (E:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgE (E:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragstlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5trgF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragslgvaslevavldanrprrafrritgsalqal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5trgG (G:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgG (G:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5trgH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5trgI (I:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgI (I:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5trgJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5trgK (K:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgK (K:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5trgL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5trgM (M:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgM (M:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5trgN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5trgO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragstlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5trgP (P:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgP (P:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragstlgvaslevavldanrprrafrritgsalqallvd
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5trgQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ralgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5trgR (R:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgR (R:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqall
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5trgS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragslgvaslevavldanrprrafrritgsalqallvd
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5trgT (T:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgT (T:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragtlgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5trgU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    raglgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5trgV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5trgW (W:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgW (W:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5trgX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5trgY (Y:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgY (Y:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5trgZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trgZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.