PDB entry 5tr5

View 5tr5 on RCSB PDB site
Description: Solution structure of Serine 65 phosphorylated UBL domain from parkin
Class: ligase
Keywords: phosphorylation, PINK1, Parkinson's disease, LIGASE
Deposited on 2016-10-25, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase parkin
    Species: Homo sapiens [TaxId:9606]
    Gene: PARK2, PRKN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tr5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tr5A (A:)
    mivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwtvqncd
    ldqqsivhivqrpwrk