PDB entry 5tr4

View 5tr4 on RCSB PDB site
Description: Structure of Ubiquitin activating enzyme (Uba1) in complex with ubiquitin and TAK-243
Class: ligase/ligase inhibitor
Keywords: LIGASE-LIGASE INHIBITOR complex
Deposited on 2016-10-25, released 2017-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: UBA1, YKL210W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22515 (Start-1016)
      • engineered mutation (463)
      • engineered mutation (511)
  • Chain 'B':
    Compound: Ubiquitin
    Species: Bos taurus [TaxId:9913]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG53 (0-75)
      • conflict (18)
      • conflict (23)
      • conflict (27)
    Domains in SCOPe 2.08: d5tr4b_
  • Chain 'C':
    Compound: Ubiquitin-activating enzyme E1 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: UBA1, YKL210W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22515 (Start-1016)
      • engineered mutation (463)
      • engineered mutation (511)
  • Chain 'D':
    Compound: Ubiquitin
    Species: Bos taurus [TaxId:9913]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG53 (0-75)
      • conflict (18)
      • conflict (23)
      • conflict (27)
    Domains in SCOPe 2.08: d5tr4d_
  • Heterogens: 61T, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tr4B (B:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tr4D (D:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg