PDB entry 5tqj

View 5tqj on RCSB PDB site
Description: Crystal structure of response regulator receiver protein from Burkholderia phymatum
Class: signaling protein
Keywords: Burkholderia phymatum, regulator, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, SIGNALING PROTEIN
Deposited on 2016-10-24, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Burkholderia phymatum [TaxId:148447]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tqja_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tqjA (A:)
    mahhhhhhmgtnkpfvvvvdddasvgrairrllrsvgiaadtytsgdefldvlsatpsyr
    pdcvildvqmpgsngievqrrlaggavpvifitahddagvretalaagaraylrkpfndv
    lfirtvcavlgiaapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqjA (A:)
    kpfvvvvdddasvgrairrllrsvgiaadtytsgdefldvlsatpsyrpdcvildvqmpg
    sngievqrrlaggavpvifitahddagvretalaagaraylrkpfndvlfirtvcavlgi
    aapl